Lineage for d5eau_1 (5eau 21-220)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) 
Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.1: 5-Epi-aristolochene synthase, N-terminal domain [48240] (1 protein) Protein 5-Epi-aristolochene synthase, N-terminal domain [48241] (1 species) Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (3 PDB entries) 
Domain d5eau_1: 5eau 21-220 [18851]
Other proteins in same PDB: d5eau_2
Details for d5eau_1
PDB Entry: 5eau (more details), 2.15 Å
PDB Description: 5-epi-aristolochene synthase from nicotiana tabacum
SCOP Domain Sequences for d5eau_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eau_1 a.102.4.1 (21-220) 5-Epi-aristolochene synthase, N-terminal domain {Tobacco (Nicotiana tabacum)}
spslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidtierlgis
yhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkfkesl
asdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhk
gvprvetrffissiydkeqs
SCOP Domain Coordinates for d5eau_1:
Click to download the PDB-style file with coordinates for d5eau_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5eau_1:
- d5eau_1 first appeared (with stable ids) in SCOP 1.55
- d5eau_1 appears in SCOP 1.59
- d5eau_1 appears in the current release, SCOPe 2.08, called d5eaua1
View in 3D
