Lineage for d1egua1 (1egu A:171-540)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100027Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 100096Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 100102Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 100110Protein Hyaluronate lyase [48237] (2 species)
  7. 100114Species Streptococcus pneumoniae [TaxId:1313] [48238] (3 PDB entries)
  8. 100115Domain d1egua1: 1egu A:171-540 [18850]
    Other proteins in same PDB: d1egua2, d1egua3

Details for d1egua1

PDB Entry: 1egu (more details), 1.56 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase at 1.56 a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1egua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egua1 a.102.3.2 (A:171-540) Hyaluronate lyase {Streptococcus pneumoniae}
kdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekfs
nyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivgn
wwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggnl
vdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgaygn
vlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisranse
ghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsll
sdagvasvpr

SCOP Domain Coordinates for d1egua1:

Click to download the PDB-style file with coordinates for d1egua1.
(The format of our PDB-style files is described here.)

Timeline for d1egua1: