Lineage for d1qaza_ (1qaz A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50021Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 50078Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 50079Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein)
  6. 50080Protein Alginate lyase A1-III [48232] (1 species)
  7. 50081Species Sphingomonas sp., A1 [TaxId:28214] [48233] (2 PDB entries)
  8. 50082Domain d1qaza_: 1qaz A: [18848]

Details for d1qaza_

PDB Entry: 1qaz (more details), 1.78 Å

PDB Description: crystal structure of alginate lyase a1-iii from sphingomonas species a1 at 1.78a resolution

SCOP Domain Sequences for d1qaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaza_ a.102.3.1 (A:) Alginate lyase A1-III {Sphingomonas sp., A1}
gshpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemv
iprrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwaka
dallnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpg
gdtsccnnhsywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqs
lhyqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepq
dtrafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsatllaykp

SCOP Domain Coordinates for d1qaza_:

Click to download the PDB-style file with coordinates for d1qaza_.
(The format of our PDB-style files is described here.)

Timeline for d1qaza_: