Lineage for d1fo2a_ (1fo2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004342Species Human (Homo sapiens) [TaxId:9606] [48229] (6 PDB entries)
  8. 2004346Domain d1fo2a_: 1fo2 A: [18847]
    complexed with ca, dmj, so4

Details for d1fo2a_

PDB Entry: 1fo2 (more details), 2.38 Å

PDB Description: crystal structure of human class i alpha1,2-mannosidase in complex with 1-deoxymannojirimycin
PDB Compounds: (A:) alpha1,2-mannosidase

SCOPe Domain Sequences for d1fo2a_:

Sequence, based on SEQRES records: (download)

>d1fo2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tqgpvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmw
ilglrkefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfg
nrlmpafrtpskipysdvnigtgvahpprwtsdstvaevtsiqlefrelsrltgdkkfqe
avekvtqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkq
etqlledyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyh
glpashmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpe
tveslfylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesf
flgetlkylfllfsddpnllsldayvfnteahplpiwt

Sequence, based on observed residues (ATOM records): (download)

>d1fo2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tqgpvhlnyrqkgvidvflhawkgyrkfawghdelkpvsrsfsewfglgltlidaldtmw
ilglrkefeearkwvskklhfekdvdvnlfestirilggllsayhlsgdslflrkaedfg
nrlmpafrtpskipysdvnigtgvahpprsdstvaevtsiqlefrelsrltgdkkfqeav
ekvtqhihglsgkkdglvpmfinthsglfthlgvftlgaradsyyeyllkqwiqggkqet
qlledyveaiegvrthllrhsepskltfvgelahgrfsakmdhlvcflpgtlalgvyhgl
pashmelaqelmetcyqmnrqmetglspeivhfnlypqpgrrdvevkpadrhnllrpetv
eslfylyrvtgdrkyqdwgweilqsfsrftrvpsggyssinnvqdpqkpeprdkmesffl
getlkylfllfsddpnllsldayvfnteahplpiwt

SCOPe Domain Coordinates for d1fo2a_:

Click to download the PDB-style file with coordinates for d1fo2a_.
(The format of our PDB-style files is described here.)

Timeline for d1fo2a_: