SCOPe 2.08: Domain d1fp3b_: 1fp3 B:

Lineage for d1fp3b_ (1fp3 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.3: N-acylglucosamine (NAG) epimerase [48222] (3 proteins)
   automatically mapped to Pfam PF07221

6. Protein N-acyl-D-glucosamine 2-epimerase [48223] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48224] (1 PDB entry)

8. Domain d1fp3b_: 1fp3 B: [18843]

Details for d1fp3b_

PDB Entry: 1fp3, 2 Å

PDB Description: crystal structure of n-acyl-d-glucosamine 2-epimerase from porcine kidney

PDB Compounds: (B:) n-acyl-d-glucosamine 2-epimerase

SCOPe Domain Sequences for d1fp3b_:

Sequence; same for both SEQRES and ATOM records:

>d1fp3b_ a.102.1.3 (B:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]}
mekeretlqawkervgqeldrvmafwlehshdrehggfftclgrdgrvyddlkyvwlqgr
qvwmycrlyrklerfhrpelldaakaggefllrharvappekkcafvltrdgrpvkvqrs
ifsecfytmamnelwrvtaearyqseavdmmdqivhwvredpsglgrpqlpgavasesma
vpmmllclveqlgeedeelagryaqlghwcarrilqhvqrdgqavlenvsedgeelsgcl
grhqnpghaleagwfllrhssrsgdaklrahvidtflllpfrsgwdadhgglfyfqdadg
lcptqlewamklwwphseamiaflmgysesgdpallrlfyqvaeytfrqfrdpeygewfg
ylnregkvaltikggpfkgcfhvprclamceemlsallsrla

Timeline for d1fp3b_:

• d1fp3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fp3b_ appears in SCOPe 2.07