Lineage for d1f9oa_ (1f9o A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5591Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (3 families) (S)
  5. 5603Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 5620Protein Processive endocellulase CelF (Cel48F) [48220] (1 species)
  7. 5621Species Clostridium cellulolyticum [TaxId:1521] [48221] (6 PDB entries)
  8. 5627Domain d1f9oa_: 1f9o A: [18841]

Details for d1f9oa_

PDB Entry: 1f9o (more details), 2.5 Å

PDB Description: crystal structure of the cellulase cel48f from c. cellulolyticum with the thiooligosaccharide inhibitor pips-ig3

SCOP Domain Sequences for d1f9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9oa_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum}
asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
qvptqrlhrfwaqsefavangvyailfpd

SCOP Domain Coordinates for d1f9oa_:

Click to download the PDB-style file with coordinates for d1f9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f9oa_: