Lineage for d1fboa_ (1fbo A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100027Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 100028Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (4 families) (S)
  5. 100040Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 100057Protein Processive endocellulase CelF (Cel48F) [48220] (1 species)
  7. 100058Species Clostridium cellulolyticum [TaxId:1521] [48221] (6 PDB entries)
  8. 100063Domain d1fboa_: 1fbo A: [18840]

Details for d1fboa_

PDB Entry: 1fbo (more details), 2.3 Å

PDB Description: crystal structure of the cellulase cel48f from c. cellulolyticum in complex with cellobiitol

SCOP Domain Sequences for d1fboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fboa_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum}
asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
qvptqrlhrfwaqsefavangvyailfpd

SCOP Domain Coordinates for d1fboa_:

Click to download the PDB-style file with coordinates for d1fboa_.
(The format of our PDB-style files is described here.)

Timeline for d1fboa_: