Lineage for d1faea_ (1fae A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5591Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (3 families) (S)
  5. 5603Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 5620Protein Processive endocellulase CelF (Cel48F) [48220] (1 species)
  7. 5621Species Clostridium cellulolyticum [TaxId:1521] [48221] (6 PDB entries)
  8. 5622Domain d1faea_: 1fae A: [18837]

Details for d1faea_

PDB Entry: 1fae (more details), 2 Å

PDB Description: crystal structure of the cellulase cel48f from c. cellulolyticum in complex with cellobiose

SCOP Domain Sequences for d1faea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faea_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum}
asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
qvptqrlhrfwaqsefavangvyailfpd

SCOP Domain Coordinates for d1faea_:

Click to download the PDB-style file with coordinates for d1faea_.
(The format of our PDB-style files is described here.)

Timeline for d1faea_: