SCOP 1.67: Domain d1clc_1: 1clc 135-575

Lineage for d1clc_1 (1clc 135-575)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (6 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (8 proteins)

6. Protein CelD cellulase, C-terminal domain [48218] (1 species)
   the other, N-terminal, domain is immunoglobulin-like

7. Species Clostridium thermocellum [TaxId:1515] [48219] (1 PDB entry)

8. Domain d1clc_1: 1clc 135-575 [18835]
   Other proteins in same PDB: d1clc_2
   complexed with ca, zn

Details for d1clc_1

PDB Entry: 1clc, 1.9 Å

PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution

SCOP Domain Sequences for d1clc_1:

Sequence; same for both SEQRES and ATOM records:

>d1clc_1 a.102.1.2 (135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum}
amnvyedafktamlgmyllrcgtsvsatyngihyshgpchtndayldyingqhtkkdstk
gwhdagdynkyvvnagitvgsmflawehfkdqlepvaleipeknnsipdfldelkyeidw
iltmqypdgsgrvahkvstrnfggfimpenehderffvpwssaatadfvamtamaarifr
pydpqyaekcinaakvsyeflknnpanvfanqsgfstgeyatvsdaddrlwaaaemwetl
gdeeylrdfenraaqfskkieadfdwdnvanlgmftyllserpgknpalvqsikdsllst
adsivrtsqnhgygrtlgttyywgcngtvvrqtmilqvankispnndyvnaaldaishvf
grnyynrsyvtglginppmnphdrrsgadgiwepwpgylvgggwpgpkdwvdiqdsyqtn
eiainwnaaliyalagfvnyn

Timeline for d1clc_1:

• d1clc_1 first appeared (with stable ids) in SCOP 1.55
  
• d1clc_1 appears in SCOP 1.65
  
• d1clc_1 appears in SCOP 1.69
  
• d1clc_1 appears in the current release, SCOPe 2.08, called d1clca1