Lineage for d1clc_1 (1clc 135-575)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284240Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (6 families) (S)
  5. 284252Family a.102.1.2: Cellulases catalytic domain [48213] (7 proteins)
  6. 284258Protein CelD cellulase, C-terminal domain [48218] (1 species)
    the other, N-terminal, domain is immunoglobulin-like
  7. 284259Species Clostridium thermocellum [TaxId:1515] [48219] (1 PDB entry)
  8. 284260Domain d1clc_1: 1clc 135-575 [18835]
    Other proteins in same PDB: d1clc_2
    complexed with ca, zn

Details for d1clc_1

PDB Entry: 1clc (more details), 1.9 Å

PDB Description: three-dimensional structure of endoglucanase d at 1.9 angstroms resolution

SCOP Domain Sequences for d1clc_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clc_1 a.102.1.2 (135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum}
amnvyedafktamlgmyllrcgtsvsatyngihyshgpchtndayldyingqhtkkdstk
gwhdagdynkyvvnagitvgsmflawehfkdqlepvaleipeknnsipdfldelkyeidw
iltmqypdgsgrvahkvstrnfggfimpenehderffvpwssaatadfvamtamaarifr
pydpqyaekcinaakvsyeflknnpanvfanqsgfstgeyatvsdaddrlwaaaemwetl
gdeeylrdfenraaqfskkieadfdwdnvanlgmftyllserpgknpalvqsikdsllst
adsivrtsqnhgygrtlgttyywgcngtvvrqtmilqvankispnndyvnaaldaishvf
grnyynrsyvtglginppmnphdrrsgadgiwepwpgylvgggwpgpkdwvdiqdsyqtn
eiainwnaaliyalagfvnyn

SCOP Domain Coordinates for d1clc_1:

Click to download the PDB-style file with coordinates for d1clc_1.
(The format of our PDB-style files is described here.)

Timeline for d1clc_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clc_2