Lineage for d3tf4b1 (3tf4 B:1-460)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5591Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (3 families) (S)
  5. 5603Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 5610Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (1 species)
  7. 5611Species Thermomonospora fusca [TaxId:2021] [48217] (4 PDB entries)
  8. 5619Domain d3tf4b1: 3tf4 B:1-460 [18834]
    Other proteins in same PDB: d3tf4a2, d3tf4b2

Details for d3tf4b1

PDB Entry: 3tf4 (more details), 2.2 Å

PDB Description: endo/exocellulase:cellotriose from thermomonospora

SCOP Domain Sequences for d3tf4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tf4b1 a.102.1.2 (B:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca}
epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
vanevatdynagfssalamlveeyggtpladfppteepdg

SCOP Domain Coordinates for d3tf4b1:

Click to download the PDB-style file with coordinates for d3tf4b1.
(The format of our PDB-style files is described here.)

Timeline for d3tf4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tf4b2