Lineage for d4tf4b1 (4tf4 B:1-460)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004112Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)
  7. 2004122Species Thermobifida fusca [TaxId:2021] [48217] (4 PDB entries)
  8. 2004128Domain d4tf4b1: 4tf4 B:1-460 [18832]
    Other proteins in same PDB: d4tf4a2, d4tf4b2
    complexed with ca

Details for d4tf4b1

PDB Entry: 4tf4 (more details), 2 Å

PDB Description: endo/exocellulase:cellopentaose from thermomonospora
PDB Compounds: (B:) t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain

SCOPe Domain Sequences for d4tf4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tf4b1 a.102.1.2 (B:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermobifida fusca [TaxId: 2021]}
epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
vanevatdynagfssalamlveeyggtpladfppteepdg

SCOPe Domain Coordinates for d4tf4b1:

Click to download the PDB-style file with coordinates for d4tf4b1.
(The format of our PDB-style files is described here.)

Timeline for d4tf4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tf4b2