SCOPe 2.07: Domain d1tf4b1: 1tf4 B:1-460

Lineage for d1tf4b1 (1tf4 B:1-460)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)

6. Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)

7. Species Thermobifida fusca [TaxId:2021] [48217] (4 PDB entries)

8. Domain d1tf4b1: 1tf4 B:1-460 [18828]
   Other proteins in same PDB: d1tf4a2, d1tf4b2
   complexed with ca

Details for d1tf4b1

PDB Entry: 1tf4, 1.9 Å

PDB Description: endo/exocellulase from thermomonospora

PDB Compounds: (B:) t. fusca endo/exo-cellulase e4 catalytic domain and cellulose-binding domain

SCOPe Domain Sequences for d1tf4b1:

Sequence; same for both SEQRES and ATOM records:

>d1tf4b1 a.102.1.2 (B:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermobifida fusca [TaxId: 2021]}
epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
vanevatdynagfssalamlveeyggtpladfppteepdg

Timeline for d1tf4b1:

• d1tf4b1 first appeared (with stable ids) in SCOP 1.55
  
• d1tf4b1 appears in SCOPe 2.06
  
• d1tf4b1 appears in the current release, SCOPe 2.08