Lineage for d1tf4b1 (1tf4 B:1-460)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50021Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 50022Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (4 families) (S)
  5. 50034Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 50041Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (1 species)
  7. 50042Species Thermomonospora fusca [TaxId:2021] [48217] (4 PDB entries)
  8. 50044Domain d1tf4b1: 1tf4 B:1-460 [18828]
    Other proteins in same PDB: d1tf4a2, d1tf4b2

Details for d1tf4b1

PDB Entry: 1tf4 (more details), 1.9 Å

PDB Description: endo/exocellulase from thermomonospora

SCOP Domain Sequences for d1tf4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf4b1 a.102.1.2 (B:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca}
epafnyaealqksmffyeaqrsgklpennrvswrgdsglndgadvgldltggwydagdhv
kfgfpmaftatmlawgaiespegyirsgqmpylkdnlrwvndyfikahpspnvlyvqvgd
gdadhkwwgpaevmpmerpsfkvdpscpgsdvaaetaaamaassivfadddpayaatlvq
hakqlytfadtyrgvysdcvpagafynswsgyqdelvwgaywlykatgddsylakaeyey
dflsteqqtdlrsyrwtiawddksygtyvllaketgkqkyiddanrwldywtvgvngqrv
pyspggmavldtwgalryaantafvalvyakviddpvrkqryhdfavrqinyalgdnprn
ssyvvgfgnnpprnphhrtahgswtdsiaspaenrhvlygalvggpgspndaytddrqdy
vanevatdynagfssalamlveeyggtpladfppteepdg

SCOP Domain Coordinates for d1tf4b1:

Click to download the PDB-style file with coordinates for d1tf4b1.
(The format of our PDB-style files is described here.)

Timeline for d1tf4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tf4b2