Lineage for d1cem__ (1cem -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5591Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (3 families) (S)
  5. 5603Family a.102.1.2: Cellulases catalytic domain [48213] (4 proteins)
  6. 5604Protein CelA cellulase [48214] (1 species)
  7. 5605Species Clostridium thermocellum [TaxId:1515] [48215] (1 PDB entry)
  8. 5606Domain d1cem__: 1cem - [18826]

Details for d1cem__

PDB Entry: 1cem (more details), 1.65 Å

PDB Description: endoglucanase a (cela) catalytic core, residues 33-395

SCOP Domain Sequences for d1cem__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cem__ a.102.1.2 (-) CelA cellulase {Clostridium thermocellum}
agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
vsegmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
adedialalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
sdl

SCOP Domain Coordinates for d1cem__:

Click to download the PDB-style file with coordinates for d1cem__.
(The format of our PDB-style files is described here.)

Timeline for d1cem__: