Lineage for d1cema_ (1cem A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722055Protein CelA cellulase [48214] (2 species)
  7. 2722059Species Clostridium thermocellum [TaxId:1515] [48215] (3 PDB entries)
  8. 2722062Domain d1cema_: 1cem A: [18826]

Details for d1cema_

PDB Entry: 1cem (more details), 1.65 Å

PDB Description: endoglucanase a (cela) catalytic core, residues 33-395
PDB Compounds: (A:) cellulase cela (1,4-beta-d-glucan-glucanohydrolase)

SCOPe Domain Sequences for d1cema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cema_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum [TaxId: 1515]}
agvpfntkypygptsiadnqsevtamlkaewedwkskritsngaggykrvqrdastnydt
vsegmgyglllavcfneqalfddlyryvkshfngnglmhwhidannnvtshdggdgaatd
adedialalifadkqwgssgainygqeartlinnlynhcvehgsyvlkpgdrwggssvtn
psyfapawykvyaqytgdtrwnqvadkcyqiveevkkynngtglvpdwctasgtpasgqs
ydykydatrygwrtavdyswfgdqrakancdmltkffardgakgivdgytiqgskisnnh
nasfigpvaaasmtgydlnfakelyretvavkdseyygyygnslrlltllyitgnfpnpl
sdl

SCOPe Domain Coordinates for d1cema_:

Click to download the PDB-style file with coordinates for d1cema_.
(The format of our PDB-style files is described here.)

Timeline for d1cema_: