Lineage for d1ayxa_ (1ayx A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. Family a.102.1.1: Glucoamylase [48209] (2 proteins)
    automatically mapped to Pfam PF00723
  6. Protein Glucoamylase [48210] (2 species)
  7. Species Yeast (Saccharomycopsis fibuligera) [TaxId:4944] [48212] (3 PDB entries)
  8. Domain d1ayxa_: 1ayx A: [18825]
    complexed with trs

Details for d1ayxa_

PDB Entry: 1ayx (more details), 1.7 Å

PDB Description: crystal structure of glucoamylase from saccharomycopsis fibuligera at 1.7 angstroms
PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d1ayxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayxa_ a.102.1.1 (A:) Glucoamylase {Yeast (Saccharomycopsis fibuligera) [TaxId: 4944]}
aypsfeaysnykvdrtdletfldkqkevslyyllqniaypegqfnngvpgtviaspstsn
pdyyyqwtrdsaitfltvlselednnfnttlakaveyyintsynlqrtsnpsgsfddenh
kglgepkfntdgsaytgawgrpqndgpalrayaisrylndvnslnegklvltdsgdinfs
stediykniikpdleyvigywdstgfdlweenqgrhfftslvqqkalayavdiaksfddg
dfantlsstastlesylsgsdggfvntdvnhivenpdllqqnsrqgldsatyigpllthd
igessstpfdvdneyvlqsyylllednkdrysvnsaysagaaigrypedvyngdgssegn
pwflatayaaqvpyklaydaksasnditinkinydffnkyivdlstinsayqssdsvtik
sgsdefntvadnlvtfgdsflqvildhinddgslneqlnrytgystgaysltwssgalle
airlrnkvkala

SCOPe Domain Coordinates for d1ayxa_ are not available.

Timeline for d1ayxa_: