Lineage for d1agm__ (1agm -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5590Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 5591Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (3 families) (S)
  5. 5592Family a.102.1.1: Glucoamylase [48209] (1 protein)
  6. 5593Protein Glucoamylase [48210] (2 species)
  7. 5594Species Aspergillus awamori, variant x100 [TaxId:105351] [48211] (6 PDB entries)
  8. 5600Domain d1agm__: 1agm - [18824]

Details for d1agm__

PDB Entry: 1agm (more details), 2.4 Å

PDB Description: refined structure for the complex of acarbose with glucoamylase from aspergillus awamori var. x100 to 2.4 angstroms resolution

SCOP Domain Sequences for d1agm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agm__ a.102.1.1 (-) Glucoamylase {Aspergillus awamori, variant x100}
atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvi
ktlvdlfrngdtdllstiehyissqaiiqgvsnpsgdlssgglgepkfnvdetaytgswg
rpqrdgpalratamigfgqwlldngytsaateivwplvrndlsyvaqywnqtgydlweev
ngssfftiavqhralvegsafatavgsscswcdsqapqilcylqsfwtgsyilanfdssr
sgkdtntllgsihtfdpeagcddstfqpcspralanhkevvdsfrsiytlndglsdseav
avgrypedsyyngnpwflctlaaaeqlydalyqwdkqgsleitdvsldffkalysgaatg
tyssssstyssivsavktfadgfvsivethaasngslseqfdksdgdelsardltwsyaa
lltannrrnsvvppswgetsassvpgtcaatsasgtyssvtvtswpsiva

SCOP Domain Coordinates for d1agm__:

Click to download the PDB-style file with coordinates for d1agm__.
(The format of our PDB-style files is described here.)

Timeline for d1agm__: