Lineage for d1doga_ (1dog A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276657Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1276658Family a.102.1.1: Glucoamylase [48209] (2 proteins)
    automatically mapped to Pfam PF00723
  6. 1276659Protein Glucoamylase [48210] (2 species)
  7. 1276660Species Aspergillus awamori, variant x100 [TaxId:105351] [48211] (6 PDB entries)
  8. 1276664Domain d1doga_: 1dog A: [18823]
    complexed with man, noj

Details for d1doga_

PDB Entry: 1dog (more details), 2.3 Å

PDB Description: refined structure for the complex of 1-deoxynojirimycin with glucoamylase from (aspergillus awamori) var. x100 to 2.4 angstroms resolution
PDB Compounds: (A:) glucoamylase-471

SCOPe Domain Sequences for d1doga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doga_ a.102.1.1 (A:) Glucoamylase {Aspergillus awamori, variant x100 [TaxId: 105351]}
atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvi
ktlvdlfrngdtdllstiehyissqaiiqgvsnpsgdlssgglgepkfnvdetaytgswg
rpqrdgpalratamigfgqwlldngytsaateivwplvrndlsyvaqywnqtgydlweev
ngssfftiavqhralvegsafatavgsscswcdsqapqilcylqsfwtgsyilanfdssr
sgkdtntllgsihtfdpeagcddstfqpcspralanhkevvdsfrsiytlndglsdseav
avgrypedsyyngnpwflctlaaaeqlydalyqwdkqgsleitdvsldffkalysgaatg
tyssssstyssivsavktfadgfvsivethaasngslseqfdksdgdelsardltwsyaa
lltannrrnsvvppswgetsassvpgtcaatsasgtyssvtvtswpsiva

SCOPe Domain Coordinates for d1doga_:

Click to download the PDB-style file with coordinates for d1doga_.
(The format of our PDB-style files is described here.)

Timeline for d1doga_: