Lineage for d1glma_ (1glm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004060Family a.102.1.1: Glucoamylase [48209] (2 protein domains)
    automatically mapped to Pfam PF00723
  6. 2004061Protein Glucoamylase [48210] (2 species)
  7. 2004062Species Aspergillus awamori, variant x100 [TaxId:105351] [48211] (6 PDB entries)
  8. 2004067Domain d1glma_: 1glm A: [18821]
    complexed with man

Details for d1glma_

PDB Entry: 1glm (more details), 2.4 Å

PDB Description: refined crystal structures of glucoamylase from aspergillus awamori var. x100
PDB Compounds: (A:) glucoamylase-471

SCOPe Domain Sequences for d1glma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glma_ a.102.1.1 (A:) Glucoamylase {Aspergillus awamori, variant x100 [TaxId: 105351]}
atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvi
ktlvdlfrngdtdllstiehyissqaiiqgvsnpsgdlssgglgepkfnvdetaytgswg
rpqrdgpalratamigfgqwlldngytsaateivwplvrndlsyvaqywnqtgydlweev
ngssfftiavqhralvegsafatavgsscswcdsqapqilcylqsfwtgsyilanfdssr
sgkdtntllgsihtfdpeagcddstfqpcspralanhkevvdsfrsiytlndglsdseav
avgrypedsyyngnpwflctlaaaeqlydalyqwdkqgsleitdvsldffkalysgaatg
tyssssstyssivsavktfadgfvsivethaasngslseqfdksdgdelsardltwsyaa
lltannrrnsvvppswgetsassvpgtcaatsasgtyssvtvtswpsiva

SCOPe Domain Coordinates for d1glma_:

Click to download the PDB-style file with coordinates for d1glma_.
(The format of our PDB-style files is described here.)

Timeline for d1glma_: