Lineage for d1utra_ (1utr A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5577Fold a.101: Uteroglobin-like [48200] (1 superfamily)
  4. 5578Superfamily a.101.1: Uteroglobin-like [48201] (1 family) (S)
  5. 5579Family a.101.1.1: Uteroglobin-like [48202] (2 proteins)
  6. 5580Protein Clara cell 17kDa protein [48205] (1 species)
  7. 5581Species Rat (Rattus norvegicus) [TaxId:10116] [48206] (2 PDB entries)
  8. 5583Domain d1utra_: 1utr A: [18817]

Details for d1utra_

PDB Entry: 1utr (more details)

PDB Description: uteroglobin-pcb complex (reduced form)

SCOP Domain Sequences for d1utra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utra_ a.101.1.1 (A:) Clara cell 17kDa protein {Rat (Rattus norvegicus)}
icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
kiltsplc

SCOP Domain Coordinates for d1utra_:

Click to download the PDB-style file with coordinates for d1utra_.
(The format of our PDB-style files is described here.)

Timeline for d1utra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1utrb_