Lineage for d1utra_ (1utr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329995Fold a.101: Uteroglobin-like [48200] (1 superfamily)
    multihelical
  4. 2329996Superfamily a.101.1: Uteroglobin-like [48201] (2 families) (S)
    disulfide-linked dimer of two identical chains, 4 helices in each
  5. 2329997Family a.101.1.1: Uteroglobin-like [48202] (4 protein domains)
  6. 2330014Protein Clara cell 17kDa protein [48205] (1 species)
  7. 2330015Species Norway rat (Rattus norvegicus) [TaxId:10116] [48206] (2 PDB entries)
  8. 2330017Domain d1utra_: 1utr A: [18817]
    complexed with pcb

Details for d1utra_

PDB Entry: 1utr (more details)

PDB Description: uteroglobin-pcb complex (reduced form)
PDB Compounds: (A:) uteroglobin

SCOPe Domain Sequences for d1utra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utra_ a.101.1.1 (A:) Clara cell 17kDa protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
kiltsplc

SCOPe Domain Coordinates for d1utra_:

Click to download the PDB-style file with coordinates for d1utra_.
(The format of our PDB-style files is described here.)

Timeline for d1utra_: