SCOPe 2.08: Domain d1utra_: 1utr A:

Lineage for d1utra_ (1utr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (2 families)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Clara cell 17kDa protein [48205] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48206] (2 PDB entries)

8. Domain d1utra_: 1utr A: [18817]
   complexed with pcb

Details for d1utra_

PDB Entry: 1utr

PDB Description: uteroglobin-pcb complex (reduced form)

PDB Compounds: (A:) uteroglobin

SCOPe Domain Sequences for d1utra_:

Sequence; same for both SEQRES and ATOM records:

>d1utra_ a.101.1.1 (A:) Clara cell 17kDa protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
kiltsplc

Timeline for d1utra_:

• d1utra_ first appeared (with stable ids) in SCOP 1.55
  
• d1utra_ appears in SCOPe 2.07