Lineage for d1ccd__ (1ccd -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.101: Uteroglobin-like [48200] (1 superfamily) Superfamily a.101.1: Uteroglobin-like [48201] (1 family) 
Family a.101.1.1: Uteroglobin-like [48202] (2 proteins) 
Protein Clara cell 17kDa protein [48205] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48206] (2 PDB entries) 
Domain d1ccd__: 1ccd - [18816]
Details for d1ccd__
PDB Entry: 1ccd (more details), 3 Å
PDB Description: refined structure of rat clara cell 17 kda protein at 3.0 angstroms resolution
SCOP Domain Sequences for d1ccd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccd__ a.101.1.1 (-) Clara cell 17kDa protein {Rat (Rattus norvegicus)}
ssdicpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivk
ltekiltsplceqdlrv
SCOP Domain Coordinates for d1ccd__:
Click to download the PDB-style file with coordinates for d1ccd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccd__:
- d1ccd__ first appeared (with stable ids) in SCOP 1.55
- d1ccd__ appears in SCOP 1.59
- d1ccd__ appears in the current release, SCOPe 2.08, called d1ccda_
View in 3D