SCOPe 2.08: Domain d2utgb_: 2utg B:

Lineage for d2utgb_ (2utg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (2 families)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Uteroglobin [48203] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48204] (2 PDB entries)

8. Domain d2utgb_: 2utg B: [18815]

Details for d2utgb_

PDB Entry: 2utg, 1.64 Å

PDB Description: structure and refinement of the oxidized p21 form of uteroglobin at 1.64 angstroms resolution

PDB Compounds: (B:) uteroglobin

SCOPe Domain Sequences for d2utgb_:

Sequence; same for both SEQRES and ATOM records:

>d2utgb_ a.101.1.1 (B:) Uteroglobin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt
ekivksplcm

Timeline for d2utgb_:

• d2utgb_ first appeared (with stable ids) in SCOP 1.55
  
• d2utgb_ appears in SCOPe 2.07