![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.101: Uteroglobin-like [48200] (1 superfamily) multihelical |
![]() | Superfamily a.101.1: Uteroglobin-like [48201] (2 families) ![]() disulfide-linked dimer of two identical chains, 4 helices in each |
![]() | Family a.101.1.1: Uteroglobin-like [48202] (4 proteins) |
![]() | Protein Uteroglobin [48203] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48204] (2 PDB entries) |
![]() | Domain d2utga_: 2utg A: [18814] |
PDB Entry: 2utg (more details), 1.64 Å
SCOPe Domain Sequences for d2utga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2utga_ a.101.1.1 (A:) Uteroglobin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt ekivksplcm
Timeline for d2utga_: