Lineage for d1bg6a1 (1bg6 A:188-359)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003567Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2003568Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2003696Family a.100.1.5: N-(1-D-carboxylethyl)-L-norvaline dehydrogenase [48194] (1 protein)
    automatically mapped to Pfam PF02317
  6. 2003697Protein N-(1-D-carboxylethyl)-L-norvaline dehydrogenase [48195] (1 species)
  7. 2003698Species Arthrobacter, strain 1c [TaxId:1663] [48196] (1 PDB entry)
  8. 2003699Domain d1bg6a1: 1bg6 A:188-359 [18810]
    Other proteins in same PDB: d1bg6a2

Details for d1bg6a1

PDB Entry: 1bg6 (more details), 1.8 Å

PDB Description: crystal structure of the n-(1-d-carboxylethyl)-l-norvaline dehydrogenase from arthrobacter sp. strain 1c
PDB Compounds: (A:) n-(1-d-carboxylethyl)-l-norvaline dehydrogenase

SCOPe Domain Sequences for d1bg6a1:

Sequence, based on SEQRES records: (download)

>d1bg6a1 a.100.1.5 (A:188-359) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}
nvlhtsltnvnavmhplptllnaarcesgtpfqyylegitpsvgslaekvdaeriaiaka
fdlnvpsvcewykesygqspatiyeavqgnpayrgiagpinlntryffedvstglvplse
lgravnvptplidavldlisslidtdfrkegrtleklglsgltaagirsave

Sequence, based on observed residues (ATOM records): (download)

>d1bg6a1 a.100.1.5 (A:188-359) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}
nvlhtsltnvnavmhplptllnaarcesgtpfqyylegitpsvgslaekvdaeriaiaka
fdlnvpsvcewypatiyeavqgnpayrgiagpinlntryffedvstglvplselgravnv
ptplidavldlisslidtdfrkegrtleklglsgltaagirsave

SCOPe Domain Coordinates for d1bg6a1:

Click to download the PDB-style file with coordinates for d1bg6a1.
(The format of our PDB-style files is described here.)

Timeline for d1bg6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg6a2