Lineage for d1dlia1 (1dli A:197-294)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334531Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins)
    automatically mapped to Pfam PF00984
  6. 2334546Protein UDP-glucose dehydrogenase (UDPGDH), middle domain [48192] (1 species)
  7. 2334547Species Streptococcus pyogenes [TaxId:1314] [48193] (2 PDB entries)
  8. 2334549Domain d1dlia1: 1dli A:197-294 [18809]
    Other proteins in same PDB: d1dlia2, d1dlia3
    complexed with gol, nad, so4, udx

Details for d1dlia1

PDB Entry: 1dli (more details), 2.31 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation
PDB Compounds: (A:) udp-glucose dehydrogenase

SCOPe Domain Sequences for d1dlia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlia1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]}
aseaeavklfantylalrvayfneldtyaesrklnshmiiqgisyddrigmhynnpsfgy
ggyclpkdtkqllanynnipqtlieaivssnnvrksyi

SCOPe Domain Coordinates for d1dlia1:

Click to download the PDB-style file with coordinates for d1dlia1.
(The format of our PDB-style files is described here.)

Timeline for d1dlia1: