SCOP 1.75: Domain d1dlia1: 1dli A:197-294

Lineage for d1dlia1 (1dli A:197-294)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins)

6. Protein UDP-glucose dehydrogenase (UDPGDH), middle domain [48192] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [48193] (2 PDB entries)

8. Domain d1dlia1: 1dli A:197-294 [18809]
   Other proteins in same PDB: d1dlia2, d1dlia3
   complexed with gol, nad, so4, udx

Details for d1dlia1

PDB Entry: 1dli, 2.31 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation

PDB Compounds: (A:) udp-glucose dehydrogenase

SCOP Domain Sequences for d1dlia1:

Sequence; same for both SEQRES and ATOM records:

>d1dlia1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]}
aseaeavklfantylalrvayfneldtyaesrklnshmiiqgisyddrigmhynnpsfgy
ggyclpkdtkqllanynnipqtlieaivssnnvrksyi

Timeline for d1dlia1:

• d1dlia1 first appeared (with stable ids) in SCOP 1.55
  
• d1dlia1 appears in SCOP 1.73
  
• d1dlia1 appears in SCOPe 2.01
  
• d1dlia1 appears in the current release, SCOPe 2.08