Lineage for d1dlia1 (1dli A:197-294)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5520Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 5521Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (6 families) (S)
  5. 5563Family a.100.1.4: UDP-glucose dehydrogenase (UDPGDH), middle domain [48191] (1 protein)
  6. 5564Protein UDP-glucose dehydrogenase (UDPGDH), middle domain [48192] (1 species)
  7. 5565Species Streptococcus pyogenes [TaxId:1314] [48193] (2 PDB entries)
  8. 5567Domain d1dlia1: 1dli A:197-294 [18809]
    Other proteins in same PDB: d1dlia2, d1dlia3

Details for d1dlia1

PDB Entry: 1dli (more details), 2.31 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation

SCOP Domain Sequences for d1dlia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlia1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes}
aseaeavklfantylalrvayfneldtyaesrklnshmiiqgisyddrigmhynnpsfgy
ggyclpkdtkqllanynnipqtlieaivssnnvrksyi

SCOP Domain Coordinates for d1dlia1:

Click to download the PDB-style file with coordinates for d1dlia1.
(The format of our PDB-style files is described here.)

Timeline for d1dlia1: