Lineage for d1dlja1 (1dlj A:197-294)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49951Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 49952Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (6 families) (S)
  5. 49994Family a.100.1.4: UDP-glucose dehydrogenase (UDPGDH), middle domain [48191] (1 protein)
  6. 49995Protein UDP-glucose dehydrogenase (UDPGDH), middle domain [48192] (1 species)
  7. 49996Species Streptococcus pyogenes [TaxId:1314] [48193] (2 PDB entries)
  8. 49997Domain d1dlja1: 1dlj A:197-294 [18808]
    Other proteins in same PDB: d1dlja2, d1dlja3

Details for d1dlja1

PDB Entry: 1dlj (more details), 1.8 Å

PDB Description: the first structure of udp-glucose dehydrogenase (udpgdh) reveals the catalytic residues necessary for the two-fold oxidation

SCOP Domain Sequences for d1dlja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes}
aseaeavklfantylalrvayfneldtyaesrklnshmiiqgisyddrigmhynnpsfgy
ggyslpkdtkqllanynnipqtlieaivssnnvrksyi

SCOP Domain Coordinates for d1dlja1:

Click to download the PDB-style file with coordinates for d1dlja1.
(The format of our PDB-style files is described here.)

Timeline for d1dlja1: