SCOP 1.71: Domain d3hdhc1: 3hdh C:204-295

Lineage for d3hdhc1 (3hdh C:204-295)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (10 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Pig (Sus scrofa) [TaxId:9823] [48190] (1 PDB entry)

8. Domain d3hdhc1: 3hdh C:204-295 [18807]
   Other proteins in same PDB: d3hdha2, d3hdhb2, d3hdhc2
   complexed with nad

Details for d3hdhc1

PDB Entry: 3hdh, 2.8 Å

PDB Description: pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination

SCOP Domain Sequences for d3hdhc1:

Sequence, based on SEQRES records:

>d3hdhc1 a.100.1.3 (C:204-295) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa)}
gfivnrllvpylieavrlyergdaskedidtamklgagypmgpfelldyvgldttkfiid
gwhemdsqnplfqpspamnklvaenkfgkktg

Sequence, based on observed residues (ATOM records):

>d3hdhc1 a.100.1.3 (C:204-295) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa)}
gfivnrllvpylieavrlyekedidtamklgagpfelldyvgldttkfiidgwhespamn
klvaenkfgkktg

Timeline for d3hdhc1:

• d3hdhc1 first appeared (with stable ids) in SCOP 1.55
  
• d3hdhc1 appears in SCOP 1.69
  
• d3hdhc1 appears in SCOP 1.73
  
• d3hdhc1 appears in the current release, SCOPe 2.08