SCOPe 2.08: Domain d3hdhb1: 3hdh B:204-302

Lineage for d3hdhb1 (3hdh B:204-302)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Pig (Sus scrofa) [TaxId:9823] [48190] (1 PDB entry)

8. Domain d3hdhb1: 3hdh B:204-302 [18806]
   Other proteins in same PDB: d3hdha2, d3hdhb2, d3hdhc2
   complexed with nad

Details for d3hdhb1

PDB Entry: 3hdh, 2.8 Å

PDB Description: pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination

PDB Compounds: (B:) protein (l-3-hydroxyacyl coa dehydrogenase)

SCOPe Domain Sequences for d3hdhb1:

Sequence; same for both SEQRES and ATOM records:

>d3hdhb1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
gfivnrllvpylieavrlyergdaskedidtamklgagypmgpfelldyvgldttkfiid
gwhemdsqnplfqpspamnklvaenkfgkktgegfykyk

Timeline for d3hdhb1:

• d3hdhb1 first appeared (with stable ids) in SCOP 1.55
  
• d3hdhb1 appears in SCOPe 2.07