SCOPe 2.08: Domain d1f12b1: 1f12 B:204-302

Lineage for d1f12b1 (1f12 B:204-302)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)

8. Domain d1f12b1: 1f12 B:204-302 [18804]
   Other proteins in same PDB: d1f12a2, d1f12a3, d1f12b2
   complexed with 3hc

Details for d1f12b1

PDB Entry: 1f12, 2.4 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa

PDB Compounds: (B:) l-3-hydroxyacyl-coa dehydrogenase

SCOPe Domain Sequences for d1f12b1:

Sequence; same for both SEQRES and ATOM records:

>d1f12b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

Timeline for d1f12b1:

• d1f12b1 first appeared (with stable ids) in SCOP 1.55
  
• d1f12b1 appears in SCOPe 2.07