Lineage for d3hadb1 (3had B:204-302)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773947Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 773948Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 773991Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 774010Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
    Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI
  7. 774011Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)
  8. 774015Domain d3hadb1: 3had B:204-302 [18800]
    Other proteins in same PDB: d3hada2, d3hadb2

Details for d3hadb1

PDB Entry: 3had (more details), 2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
PDB Compounds: (B:) protein (l-3-hydroxyacyl coa dehydrogenase)

SCOP Domain Sequences for d3hadb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hadb1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOP Domain Coordinates for d3hadb1:

Click to download the PDB-style file with coordinates for d3hadb1.
(The format of our PDB-style files is described here.)

Timeline for d3hadb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hadb2