Lineage for d3hada1 (3had A:204-302)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334484Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 2334503Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
    Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI
  7. 2334504Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)
  8. 2334507Domain d3hada1: 3had A:204-302 [18799]
    Other proteins in same PDB: d3hada2, d3hada3, d3hadb2
    complexed with nad

Details for d3hada1

PDB Entry: 3had (more details), 2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
PDB Compounds: (A:) protein (l-3-hydroxyacyl coa dehydrogenase)

SCOPe Domain Sequences for d3hada1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hada1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOPe Domain Coordinates for d3hada1:

Click to download the PDB-style file with coordinates for d3hada1.
(The format of our PDB-style files is described here.)

Timeline for d3hada1: