![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins) |
![]() | Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species) Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries) |
![]() | Domain d1f17b1: 1f17 B:204-302 [18798] Other proteins in same PDB: d1f17a2, d1f17a3, d1f17b2 complexed with nai |
PDB Entry: 1f17 (more details), 2.3 Å
SCOPe Domain Sequences for d1f17b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f17b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd gwhemdaenplhqpspslnklvaenkfgkktgegfykyk
Timeline for d1f17b1: