SCOPe 2.03: Domain d1f17a1: 1f17 A:204-304

Lineage for d1f17a1 (1f17 A:204-304)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)

8. Domain d1f17a1: 1f17 A:204-304 [18797]
   Other proteins in same PDB: d1f17a2, d1f17b2
   complexed with nai

Details for d1f17a1

PDB Entry: 1f17, 2.3 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with nadh

PDB Compounds: (A:) l-3-hydroxyacyl-coa dehydrogenase

SCOPe Domain Sequences for d1f17a1:

Sequence; same for both SEQRES and ATOM records:

>d1f17a1 a.100.1.3 (A:204-304) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykykle

Timeline for d1f17a1:

• d1f17a1 first appeared (with stable ids) in SCOP 1.55
  
• d1f17a1 appears in SCOPe 2.02
  
• d1f17a1 appears in SCOPe 2.04
  
• d1f17a1 appears in the current release, SCOPe 2.08