SCOPe 2.08: Domain d2hdha1: 2hdh A:204-304

Lineage for d2hdha1 (2hdh A:204-304)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)

6. Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
   Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI

7. Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)

8. Domain d2hdha1: 2hdh A:204-304 [18795]
   Other proteins in same PDB: d2hdha2, d2hdhb2
   complexed with nad

Details for d2hdha1

PDB Entry: 2hdh, 2.2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism

PDB Compounds: (A:) l-3-hydroxyacyl coa dehydrogenase

SCOPe Domain Sequences for d2hdha1:

Sequence; same for both SEQRES and ATOM records:

>d2hdha1 a.100.1.3 (A:204-304) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykykaa

Timeline for d2hdha1:

• d2hdha1 first appeared (with stable ids) in SCOP 1.55
  
• d2hdha1 appears in SCOPe 2.07