Lineage for d2hdha1 (2hdh A:204-304)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721386Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 2721405Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
    Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI
  7. 2721406Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)
  8. 2721409Domain d2hdha1: 2hdh A:204-304 [18795]
    Other proteins in same PDB: d2hdha2, d2hdhb2
    complexed with nad

Details for d2hdha1

PDB Entry: 2hdh (more details), 2.2 Å

PDB Description: biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
PDB Compounds: (A:) l-3-hydroxyacyl coa dehydrogenase

SCOPe Domain Sequences for d2hdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hdha1 a.100.1.3 (A:204-304) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykykaa

SCOPe Domain Coordinates for d2hdha1:

Click to download the PDB-style file with coordinates for d2hdha1.
(The format of our PDB-style files is described here.)

Timeline for d2hdha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hdha2