Lineage for d1f0ya1 (1f0y A:204-302)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5520Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 5521Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (6 families) (S)
  5. 5544Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)
  6. 5545Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
  7. 5546Species Human (Homo sapiens) [TaxId:9606] [48189] (6 PDB entries)
  8. 5547Domain d1f0ya1: 1f0y A:204-302 [18793]
    Other proteins in same PDB: d1f0ya2, d1f0yb2

Details for d1f0ya1

PDB Entry: 1f0y (more details), 1.8 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and nad+

SCOP Domain Sequences for d1f0ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOP Domain Coordinates for d1f0ya1:

Click to download the PDB-style file with coordinates for d1f0ya1.
(The format of our PDB-style files is described here.)

Timeline for d1f0ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f0ya2