SCOPe 2.06: Domain d1yvel1: 1yve L:308-595

Lineage for d1yvel1 (1yve L:308-595)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)

6. Protein Class II ketol-acid reductoisomerase [48185] (1 species)
   duplication; contains two structural repeats swapped to fold into a figure eight knot

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [48186] (2 PDB entries)

8. Domain d1yvel1: 1yve L:308-595 [18792]
   Other proteins in same PDB: d1yvei2, d1yvej2, d1yvek2, d1yvel2
   complexed with cl, hio, mg, ndp

Details for d1yvel1

PDB Entry: 1yve, 1.65 Å

PDB Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)

PDB Compounds: (L:) acetohydroxy acid isomeroreductase

SCOPe Domain Sequences for d1yvel1:

Sequence; same for both SEQRES and ATOM records:

>d1yvel1 a.100.1.2 (L:308-595) Class II ketol-acid reductoisomerase {Spinach (Spinacia oleracea) [TaxId: 3562]}
leqeyksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistk
gmlalynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsys
eiinesvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdng
apinqdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa

Timeline for d1yvel1:

• d1yvel1 first appeared (with stable ids) in SCOP 1.55
  
• d1yvel1 appears in SCOPe 2.05
  
• d1yvel1 appears in SCOPe 2.07
  
• d1yvel1 appears in the current release, SCOPe 2.08