SCOP 1.71: Domain d1yvek1: 1yve K:308-595

Lineage for d1yvek1 (1yve K:308-595)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (10 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (2 proteins)

6. Protein Class II ketol-acid reductoisomerase [48185] (1 species)
   duplication; contains two structural repeats swapped to fold into a figure eight knot

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [48186] (2 PDB entries)

8. Domain d1yvek1: 1yve K:308-595 [18791]
   Other proteins in same PDB: d1yvei2, d1yvej2, d1yvek2, d1yvel2

Details for d1yvek1

PDB Entry: 1yve, 1.65 Å

PDB Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)

SCOP Domain Sequences for d1yvek1:

Sequence; same for both SEQRES and ATOM records:

>d1yvek1 a.100.1.2 (K:308-595) Class II ketol-acid reductoisomerase {Spinach (Spinacia oleracea)}
leqeyksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistk
gmlalynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsys
eiinesvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdng
apinqdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa

Timeline for d1yvek1:

• d1yvek1 first appeared (with stable ids) in SCOP 1.55
  
• d1yvek1 appears in SCOP 1.69
  
• d1yvek1 appears in SCOP 1.73
  
• d1yvek1 appears in the current release, SCOPe 2.08