Lineage for d1yvej1 (1yve J:308-595)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006510Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 2006517Protein Class II ketol-acid reductoisomerase [48185] (1 species)
    duplication; contains two structural repeats swapped to fold into a figure eight knot
  7. 2006518Species Spinach (Spinacia oleracea) [TaxId:3562] [48186] (2 PDB entries)
  8. 2006524Domain d1yvej1: 1yve J:308-595 [18790]
    Other proteins in same PDB: d1yvei2, d1yvej2, d1yvek2, d1yvel2
    complexed with cl, hio, mg, ndp

Details for d1yvej1

PDB Entry: 1yve (more details), 1.65 Å

PDB Description: acetohydroxy acid isomeroreductase complexed with nadph, magnesium and inhibitor ipoha (n-hydroxy-n-isopropyloxamate)
PDB Compounds: (J:) acetohydroxy acid isomeroreductase

SCOPe Domain Sequences for d1yvej1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvej1 a.100.1.2 (J:308-595) Class II ketol-acid reductoisomerase {Spinach (Spinacia oleracea) [TaxId: 3562]}
leqeyksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistk
gmlalynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsys
eiinesvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdng
apinqdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa

SCOPe Domain Coordinates for d1yvej1:

Click to download the PDB-style file with coordinates for d1yvej1.
(The format of our PDB-style files is described here.)

Timeline for d1yvej1: