SCOP 1.75: Domain d1qmga1: 1qmg A:308-595

Lineage for d1qmga1 (1qmg A:308-595)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (2 proteins)

6. Protein Class II ketol-acid reductoisomerase [48185] (1 species)
   duplication; contains two structural repeats swapped to fold into a figure eight knot

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [48186] (2 PDB entries)

8. Domain d1qmga1: 1qmg A:308-595 [18785]
   Other proteins in same PDB: d1qmga2, d1qmgb2, d1qmgc2, d1qmgd2

Details for d1qmga1

PDB Entry: 1qmg, 1.6 Å

PDB Description: acetohydroxyacid isomeroreductase complexed with its reaction product dihydroxy-methylvalerate, manganese and adp-ribose.

PDB Compounds: (A:) acetohydroxy-acid isomeroreductase

SCOP Domain Sequences for d1qmga1:

Sequence; same for both SEQRES and ATOM records:

>d1qmga1 a.100.1.2 (A:308-595) Class II ketol-acid reductoisomerase {Spinach (Spinacia oleracea) [TaxId: 3562]}
leqeyksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistk
gmlalynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsys
eiinesvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdng
apinqdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa

Timeline for d1qmga1:

• d1qmga1 first appeared (with stable ids) in SCOP 1.55
  
• d1qmga1 appears in SCOP 1.73
  
• d1qmga1 appears in SCOPe 2.01
  
• d1qmga1 appears in the current release, SCOPe 2.08