Lineage for d1qmga1 (1qmg A:308-595)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721358Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 2721365Protein Class II ketol-acid reductoisomerase [48185] (1 species)
    duplication; contains two structural repeats swapped to fold into a figure eight knot
  7. 2721366Species Spinach (Spinacia oleracea) [TaxId:3562] [48186] (2 PDB entries)
  8. 2721367Domain d1qmga1: 1qmg A:308-595 [18785]
    Other proteins in same PDB: d1qmga2, d1qmgb2, d1qmgc2, d1qmgd2
    complexed with apx, dmv, mn, so4
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1qmga1

PDB Entry: 1qmg (more details), 1.6 Å

PDB Description: acetohydroxyacid isomeroreductase complexed with its reaction product dihydroxy-methylvalerate, manganese and adp-ribose.
PDB Compounds: (A:) acetohydroxy-acid isomeroreductase

SCOPe Domain Sequences for d1qmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmga1 a.100.1.2 (A:308-595) Class II ketol-acid reductoisomerase {Spinach (Spinacia oleracea) [TaxId: 3562]}
leqeyksdifgergillgavhgiveclfrrytesgmsedlaykntvecitgvisktistk
gmlalynslseegkkdfqaaysasyypsmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgkidqtrmwkvgekvrsvrpagdlgplypftagvyvalmmaqieilrkkghsys
eiinesvieavdslnpfmhargvsfmvdncsttarlgsrkwaprfdyilsqqalvavdng
apinqdlisnflsdpvheaigvcaqlrpsvdisvtadadfvrpelrqa

SCOPe Domain Coordinates for d1qmga1:

Click to download the PDB-style file with coordinates for d1qmga1.
(The format of our PDB-style files is described here.)

Timeline for d1qmga1: