Lineage for d1pgjb1 (1pgj B:179-478)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334423Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 2334424Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
    duplication; contains two structural repeats
  7. 2334431Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [48183] (1 PDB entry)
  8. 2334433Domain d1pgjb1: 1pgj B:179-478 [18784]
    Other proteins in same PDB: d1pgja2, d1pgjb2
    complexed with so4

Details for d1pgjb1

PDB Entry: 1pgj (more details), 2.82 Å

PDB Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase

SCOPe Domain Sequences for d1pgjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgjb1 a.100.1.1 (B:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gagscvkmyhnsgeyailqiwgevfdilramglnndevaavledwksknflksymldisi
aaarakdkdgsyltehvmdrigskgtglwsaqealeigvpapslnmavvsrqftmykter
qanasnapgitqspgytlknkspsgpeikqlydsvciaiiscyaqmfqclremdkvhnfg
lnlpatiatfragcilqgyllkpmteafeknpnisnlmcafqteiraglqnyrdmvalit
sklevsipvlsaslnyvtamftptlkygqlvslqrdvfgrhgyervdkdgresfqwpelq

SCOPe Domain Coordinates for d1pgjb1:

Click to download the PDB-style file with coordinates for d1pgjb1.
(The format of our PDB-style files is described here.)

Timeline for d1pgjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgjb2