SCOP 1.65: Domain d1pgjb1: 1pgj B:179-478

Lineage for d1pgjb1 (1pgj B:179-478)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: 6-phosphogluconate dehydrogenase (6PGD) [48180] (1 protein)

6. Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
   duplication; contains two clear structural repeats, 5 helices each

7. Species Trypanosoma brucei [TaxId:5691] [48183] (1 PDB entry)

8. Domain d1pgjb1: 1pgj B:179-478 [18784]
   Other proteins in same PDB: d1pgja2, d1pgjb2
   complexed with so4

Details for d1pgjb1

PDB Entry: 1pgj, 2.8 Å

PDB Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei

SCOP Domain Sequences for d1pgjb1:

Sequence; same for both SEQRES and ATOM records:

>d1pgjb1 a.100.1.1 (B:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei}
gagscvkmyhnsgeyailqiwgevfdilramglnndevaavledwksknflksymldisi
aaarakdkdgsyltehvmdrigskgtglwsaqealeigvpapslnmavvsrqftmykter
qanasnapgitqspgytlknkspsgpeikqlydsvciaiiscyaqmfqclremdkvhnfg
lnlpatiatfragcilqgyllkpmteafeknpnisnlmcafqteiraglqnyrdmvalit
sklevsipvlsaslnyvtamftptlkygqlvslqrdvfgrhgyervdkdgresfqwpelq

Timeline for d1pgjb1:

• d1pgjb1 first appeared (with stable ids) in SCOP 1.55
  
• d1pgjb1 appears in SCOP 1.63
  
• d1pgjb1 appears in SCOP 1.67
  
• d1pgjb1 appears in the current release, SCOPe 2.08