Lineage for d1pgjb1 (1pgj B:179-478)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284127Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 284128Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 284129Family a.100.1.1: 6-phosphogluconate dehydrogenase (6PGD) [48180] (1 protein)
  6. 284130Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
    duplication; contains two clear structural repeats, 5 helices each
  7. 284137Species Trypanosoma brucei [TaxId:5691] [48183] (1 PDB entry)
  8. 284139Domain d1pgjb1: 1pgj B:179-478 [18784]
    Other proteins in same PDB: d1pgja2, d1pgjb2
    complexed with so4

Details for d1pgjb1

PDB Entry: 1pgj (more details), 2.8 Å

PDB Description: x-ray structure of 6-phosphogluconate dehydrogenase from the protozoan parasite t. brucei

SCOP Domain Sequences for d1pgjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgjb1 a.100.1.1 (B:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei}
gagscvkmyhnsgeyailqiwgevfdilramglnndevaavledwksknflksymldisi
aaarakdkdgsyltehvmdrigskgtglwsaqealeigvpapslnmavvsrqftmykter
qanasnapgitqspgytlknkspsgpeikqlydsvciaiiscyaqmfqclremdkvhnfg
lnlpatiatfragcilqgyllkpmteafeknpnisnlmcafqteiraglqnyrdmvalit
sklevsipvlsaslnyvtamftptlkygqlvslqrdvfgrhgyervdkdgresfqwpelq

SCOP Domain Coordinates for d1pgjb1:

Click to download the PDB-style file with coordinates for d1pgjb1.
(The format of our PDB-style files is described here.)

Timeline for d1pgjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgjb2