| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.1: 6-phosphogluconate dehydrogenase (6PGD) [48180] (1 protein) |
| Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species) duplication; contains two clear structural repeats, 5 helices each |
| Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries) |
| Domain d1pgq_1: 1pgq 177-473 [18782] Other proteins in same PDB: d1pgq_2 complexed with 2am, so4 |
PDB Entry: 1pgq (more details), 3.17 Å
SCOP Domain Sequences for d1pgq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgq_1 a.100.1.1 (177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries)}
gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita
silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag
ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg
Timeline for d1pgq_1: