SCOPe 2.08: Domain d1pgqa1: 1pgq A:177-473

Lineage for d1pgqa1 (1pgq A:177-473)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
   Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

6. Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
   duplication; contains two structural repeats

7. Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries)

8. Domain d1pgqa1: 1pgq A:177-473 [18782]
   Other proteins in same PDB: d1pgqa2
   complexed with 2am, so4
   multiple common domains: applies to families that are inconsistently divided into domains

Details for d1pgqa1

PDB Entry: 1pgq, 3.17 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase

SCOPe Domain Sequences for d1pgqa1:

Sequence; same for both SEQRES and ATOM records:

>d1pgqa1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]}
gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita
silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag
ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg

Timeline for d1pgqa1:

• d1pgqa1 first appeared (with stable ids) in SCOP 1.55, called d1pgq_1
  
• d1pgqa1 appears in SCOPe 2.07