Class a: All alpha proteins [46456] (226 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (10 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species) duplication; contains two structural repeats |
Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries) |
Domain d1pgp_1: 1pgp 177-473 [18780] Other proteins in same PDB: d1pgp_2 complexed with 6pg, so4 |
PDB Entry: 1pgp (more details), 2.5 Å
SCOP Domain Sequences for d1pgp_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgp_1 a.100.1.1 (177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries)} gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg
Timeline for d1pgp_1: