SCOP 1.63: Domain d1pgp_1: 1pgp 177-473

Lineage for d1pgp_1 (1pgp 177-473)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: 6-phosphogluconate dehydrogenase (6PGD) [48180] (1 protein)

6. Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
   duplication; contains two clear structural repeats, 5 helices each

7. Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries)

8. Domain d1pgp_1: 1pgp 177-473 [18780]
   Other proteins in same PDB: d1pgp_2
   complexed with 6pg, so4

Details for d1pgp_1

PDB Entry: 1pgp, 2.5 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism

SCOP Domain Sequences for d1pgp_1:

Sequence; same for both SEQRES and ATOM records:

>d1pgp_1 a.100.1.1 (177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries)}
gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita
silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag
ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg

Timeline for d1pgp_1:

• d1pgp_1 first appeared (with stable ids) in SCOP 1.55
  
• d1pgp_1 appears in SCOP 1.61
  
• d1pgp_1 appears in SCOP 1.65
  
• d1pgp_1 appears in the current release, SCOPe 2.08, called d1pgpa1